Antibodies

Jump to Filters
View as table Download
Rab11 (RAB11B) Goat Polyclonal Antibody
AB0082-200

USD 355.00

In Stock

Goat Polyclonal Anti-Rab11b Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Rat, Mouse
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab11b produced in E. coli.
Rab11 (RAB11B) Rabbit Polyclonal Antibody
TA346586

USD 539.00

5 Days

Rabbit Polyclonal Anti-RAB11B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB11B antibody: synthetic peptide directed towards the C terminal of human RAB11B. Synthetic peptide located within the following region: IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV