Rabbit Polyclonal GOLPH1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | GOLPH1 antibody was raised against a 16 amino acid peptide from near the amino terminus of human GOLPH1. |
Rabbit Polyclonal GOLPH1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | GOLPH1 antibody was raised against a 16 amino acid peptide from near the amino terminus of human GOLPH1. |
Rabbit Polyclonal Anti-ACBD3 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACBD3 antibody: synthetic peptide directed towards the N terminal of human ACBD3. Synthetic peptide located within the following region: EARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVL |