Goat Polyclonal Antibody against SERPINE1
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GFKIDDKGMAPALRH, from the internal region of the protein sequence according to NP_000593.1. |
Rabbit polyclonal SERPINE1 Antibody (Center)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SERPINE1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-216 amino acids from the Central region of human SERPINE1. |
Rabbit Polyclonal Anti-SERPINE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SERPINE1 antibody: synthetic peptide directed towards the C terminal of human SERPINE1. Synthetic peptide located within the following region: VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVM |
Rabbit Polyclonal Anti-SERPINE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SERPINE1 antibody: synthetic peptide directed towards the N terminal of human SERPINE1. Synthetic peptide located within the following region: VAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQ |
Germany
Japan
United Kingdom
China
