Antibodies

Jump to Filters
View as table Download
DLL1 Rabbit Polyclonal Antibody
TA339016

USD 539.00

5 Days

Rabbit Polyclonal Anti-DLL1 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-DLL1 antibody: synthetic peptide directed towards the N terminal of human DLL1. Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP
DLL1 Goat Polyclonal Antibody
TA305657

USD 520.00

5 Days

Goat Anti-DLL1 Antibody

Applications WB
Reactivities Mouse, Rat (Expected from sequence similarity: Human)
Conjugation Unconjugated
Immunogen Peptide with sequence C-ATQRHLTVGEEWSQD, from the internal region of the protein sequence according to NP_005609.3.