Rabbit Polyclonal LDL R Antibody
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of the human LDL Receptor protein (within residues 500-550). [Swiss-Prot# P01130] |
Rabbit Polyclonal Anti-LDLR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LDLR antibody is: synthetic peptide directed towards the C-terminal region of Human LDLR. Synthetic peptide located within the following region: VDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEA |
LDL Receptor (LDLR) (500-550) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Primate |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
