Antibodies

Jump to Filters
View as table Download
EEA1 Goat Polyclonal Antibody
AB0006-200

USD 355.00

In Stock

Goat Polyclonal Anti-EEA1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide within residues 1230 aa to the C-terminus of human EEA1 produced in E. coli.
EEA1 Goat Polyclonal Antibody
AB0005-200

USD 355.00

In Stock

Goat Polyclonal Anti-EEA1 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide within residues 1,230 aa to the C-terminus of human EEA1 produced in E. coli.
EEA1 Rabbit Polyclonal Antibody
TA329101

USD 539.00

5 Days

Rabbit Polyclonal anti-EEA1 antibody

Applications IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EEA1 antibody: synthetic peptide directed towards the N terminal of human EEA1. Synthetic peptide located within the following region: LTENLLKKEQDYTKLEEKHNEESVSKKNIQATLHQKDLDCQQLQSRLSAS
EEA1 Goat Polyclonal Antibody
TA329677

USD 520.00

5 Days

Goat Anti-EEA1 (aa821-835) Polyclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QETKIQHEELNNRIQ, from the internal region of the protein sequence according to NP_003557.2
EEA1 Rabbit Polyclonal Antibody
TA344446

USD 539.00

5 Days

Rabbit Polyclonal Anti-EEA1 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EEA1 antibody: synthetic peptide directed towards the middle region of human EEA1. Synthetic peptide located within the following region: QEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEA
EEA1 Rabbit Polyclonal Antibody
TA344445

USD 539.00

5 Days

Rabbit Polyclonal Anti-EEA1 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EEA1 antibody: synthetic peptide directed towards the N terminal of human EEA1. Synthetic peptide located within the following region: ESSSEGFICPQCMKSLGSADELFKHYEAVHDAGNDSGHGGESNLALKRDD