Rabbit Polyclonal anti-EAP30 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EAP30 antibody: synthetic peptide directed towards the N terminal of human EAP30. Synthetic peptide located within the following region: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF |
Rabbit Polyclonal Anti-SNF8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNF8 antibody: synthetic peptide directed towards the middle region of human SNF8. Synthetic peptide located within the following region: DHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQA |
Rabbit Polyclonal Anti-SNF8 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNF8 antibody: synthetic peptide directed towards the C terminal of human SNF8. Synthetic peptide located within the following region: QVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEITAEEAREALP |
Germany
Japan
United Kingdom
China
