Antibodies

Jump to Filters
View as table Download
C1R Rabbit Polyclonal Antibody
TA311909

USD 380.00

In Stock

Rabbit polyclonal C1R (heavy chain, Cleaved-Arg463) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human C1R heavy chain.
C1R Rabbit Polyclonal Antibody
TA311910

USD 380.00

In Stock

Rabbit polyclonal C1R (light chain, Cleaved-Ile464) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human C1R.
C1R Goat Polyclonal Antibody
AP21457SU-N

USD 360.00

2 Weeks

C1R goat polyclonal antibody, Serum

Applications ID, IP
Reactivities Human
Conjugation Unconjugated
Immunogen The subunit C1r is isolated as a homogenous protein for use in antiserum production.
Freund’s complete adjuvant is used in the first step of the immunization.
C1R Rabbit Polyclonal Antibody
TA342834

USD 539.00

5 Days

Rabbit Polyclonal Anti-C1R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1R antibody is: synthetic peptide directed towards the middle region of Human C1R. Synthetic peptide located within the following region: VDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDRHSCQ