Antibodies

View as table Download

Rabbit polyclonal Anti-GMPPA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GMPPA antibody: synthetic peptide directed towards the N terminal of human GMPPA. Synthetic peptide located within the following region: LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQ

GMPPA Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GMPPA

GMPPA Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GMPPA