Rabbit Polyclonal Anti-E2F6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human E2F6 |
TA349302 is a possible alternative to TA324290.
Rabbit Polyclonal Anti-E2F6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human E2F6 |
E2F6 Rabbit polyclonal Antibody
Applications | ChIP, ICC/IF, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-281 of human E2F6 (NP_937987.2). |
Modifications | Unmodified |
Rabbit polyclonal anti-E2F6 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human E2F6. |
Rabbit Polyclonal Anti-E2F6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-E2F6 antibody: synthetic peptide directed towards the middle region of human E2F6. Synthetic peptide located within the following region: HEQIVIAVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCEVEQGQTS |
Rabbit Polyclonal Anti-E2F6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-E2F6 antibody: synthetic peptide directed towards the middle region of human E2F6. Synthetic peptide located within the following region: HEQIVIAVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCEVEQGQTS |
Rabbit Polyclonal Anti-E2F6 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-E2F6 Antibody: A synthesized peptide derived from human E2F6 |
Rabbit Polyclonal Anti-E2F6 Antibody
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-E2f6 antibody is: synthetic peptide directed towards the middle region of Rat E2f6. Synthetic peptide located within the following region: RRVYDITNVLDGIELVEKKSKNHIRWIGSDLNNFGAAPQQKKLQAELSDL |