Antibodies

Jump to Filters
View as table Download
DAP5 (EIF4G2) Rabbit Polyclonal Antibody
TA345777

USD 539.00

5 Days

Rabbit Polyclonal Anti-EIF4G2 Antibody

Applications WB
Reactivities Human, Chicken, Turkey
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF4G2 antibody: synthetic peptide directed towards the C terminal of human EIF4G2. Synthetic peptide located within the following region: KGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPV