Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to HMGCL (3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 325 of HMGCL (Uniprot ID#P35914) |
Goat Polyclonal Antibody against BDH2 / DHRS6 (aa 60 to 71)
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TKKKQIDQFANE, from the internal region of the protein sequence according to NP_064524.3. |
Rabbit Polyclonal Anti-ACAT2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACAT2 antibody: synthetic peptide directed towards the middle region of human ACAT2. Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR |
Goat Polyclonal Anti-ACAT1 (aa257-269) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACAT1 (aa257-269) Antibody: Peptide with sequence C-KRVDFSKVPKLKT, from the internal region of the protein sequence according to NP_000010.1. |
Rabbit Polyclonal Anti-ACAT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH |
Rabbit Polyclonal Anti-ACAT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL |
Rabbit Polyclonal Anti-HMGCS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HMGCS1 antibody: synthetic peptide directed towards the middle region of human HMGCS1. Synthetic peptide located within the following region: KDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA |
Rabbit Polyclonal Anti-OXCT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OXCT1 antibody: synthetic peptide directed towards the N terminal of human OXCT1. Synthetic peptide located within the following region: TLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREV |
Rabbit Polyclonal Anti-OXCT1 Antibody
| Applications | WB |
| Reactivities | Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OXCT1 antibody: synthetic peptide directed towards the middle region of human OXCT1. Synthetic peptide located within the following region: GMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLIN |
Rabbit Polyclonal Anti-OXCT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OXCT2 antibody: synthetic peptide directed towards the middle region of human OXCT2. Synthetic peptide located within the following region: GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV |
Rabbit Polyclonal Anti-BDH2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDH2 antibody: synthetic peptide directed towards the middle region of human BDH2. Synthetic peptide located within the following region: NRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQAR |
Rabbit Polyclonal Anti-OXCT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human OXCT1 |
Active filters
Category
- Antibodies
Reactivities
- Human
Isotypes
- IgG
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Pathways
- Synthesis and degradation of ketone bodies