Antibodies

Jump to Filters
View as table Download
CYP4V2 Rabbit Polyclonal Antibody
TA316323

USD 380.00

In Stock

Rabbit polyclonal anti-CYP4V2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CYP4V2.
CYP4V2 Rabbit Polyclonal Antibody
TA335104

USD 539.00

5 Days

Rabbit polyclonal Anti-CYP4V2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP4V2 antibody: synthetic peptide directed towards the middle region of human CYP4V2. Synthetic peptide located within the following region: RYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI