Antibodies

View as table Download

Rabbit Polyclonal Anti-PIGK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIGK antibody: synthetic peptide directed towards the N terminal of human PIGK. Synthetic peptide located within the following region: SVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDD

Rabbit Polyclonal Anti-GPLD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPLD1 antibody is: synthetic peptide directed towards the N-terminal region of Human GPLD1. Synthetic peptide located within the following region: GKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMA

Rabbit Polyclonal Anti-PIGK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIGK antibody: synthetic peptide directed towards the N terminal of human PIGK. Synthetic peptide located within the following region: MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLV