Antibodies

Jump to Filters
View as table Download
Cyclin D1 (CCND1) Goat Polyclonal Antibody
TA329665

USD 520.00

5 Days

Goat Anti-cyclin D1 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence TRFLSRVIKCDPD, from the internal region of the protein sequence according to NP_444284.1
PI 3 Kinase p55 gamma (PIK3R3) Rabbit Polyclonal Antibody
TA330913

USD 539.00

5 Days

Rabbit Polyclonal Anti-PIK3R3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PIK3R3 antibody is: synthetic peptide directed towards the C-terminal region of Human PIK3R3. Synthetic peptide located within the following region: DAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIK
beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: IMD-110]
AM20692PU-N

USD 560.00

2 Weeks

beta Catenin (CTNNB1) mouse monoclonal antibody, clone IMD-110, Purified

Applications IF, IHC, WB
Reactivities Chicken, Human, Rat
Conjugation Unconjugated
GRB2 Mouse Monoclonal Antibody [Clone ID: 5G3-E7-F11]
TA346955

USD 380.00

4 Weeks

Mouse Monoclonal GRB2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated