Antibodies

Jump to Filters
View as table Download
Ubiquinol Cytochrome C Reductase Core Protein I (UQCRC1) Mouse Monoclonal Antibody [Clone ID: OTI1G6]
TA800089

USD 447.00

In Stock

UQCRC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated
Ubiquinol Cytochrome C Reductase Core Protein I (UQCRC1) Mouse Monoclonal Antibody [Clone ID: OTI1G6]
TA800089S

USD 200.00

In Stock

UQCRC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

UQCRC2 Rabbit Polyclonal Antibody
TA338233

USD 539.00

5 Days

Rabbit Polyclonal Anti-UQCRC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UQCRC2 antibody is: synthetic peptide directed towards the C-terminal region of Human UQCRC2. Synthetic peptide located within the following region: GIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSV