Antibodies

Jump to Filters
View as table Download
TATA binding protein (TBP) Goat Polyclonal Antibody
TA311260

USD 520.00

In Stock

Goat polyclonal anti-TBP antibody, Loading control

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence DQNNSLPPYAQ-C, from the N Terminus of the protein sequence according to NP_003185.1.
TAF2 Rabbit Polyclonal Antibody
TA334029

USD 539.00

5 Days

Rabbit Polyclonal Anti-TAF2 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAF2 Antibody: synthetic peptide directed towards the middle region of human TAF2. Synthetic peptide located within the following region: RKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKH