Antibodies

View as table Download

Rabbit polyclonal anti-Cox2 (PTGS2) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cox2.

Rabbit Polyclonal Anti-ALOX15 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ALOX15

Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20)

Rabbit Polyclonal Anti-CYP2C9 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CYP2C9

Rabbit polyclonal Anti-LTC4S Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LTC4S antibody: synthetic peptide directed towards the N terminal of human LTC4S. Synthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY