USD 447.00
In Stock
Anti-CYP2E1 (Cytochrome P450 2E1) mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 447.00
In Stock
Anti-CYP2E1 (Cytochrome P450 2E1) mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 600.00
3 Weeks
Carrier-free (BSA/glycerol-free) CYP2E1 mouse monoclonal antibody, clone OTI5F11 (formerly 5F11)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) CYP2J2 mouse monoclonal antibody, clone OTI5C5 (formerly 5C5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) CYP2J2 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 200.00
In Stock
Anti-CYP2E1 (Cytochrome P450 2E1) mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Cytochrome p450 2J2 (CYP2J2) (N-term) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human CYP2J2 |
Rabbit polyclonal Anti-LTC4S Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LTC4S antibody: synthetic peptide directed towards the N terminal of human LTC4S. Synthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY |