Antibodies

View as table Download

Anti-CYP2E1 (Cytochrome P450 2E1) mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CYP2E1 mouse monoclonal antibody, clone OTI5F11 (formerly 5F11)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CYP2J2 mouse monoclonal antibody, clone OTI5C5 (formerly 5C5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-CYP2E1 (Cytochrome P450 2E1) mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Cytochrome p450 2J2 (CYP2J2) (N-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human CYP2J2

Rabbit polyclonal Anti-LTC4S Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LTC4S antibody: synthetic peptide directed towards the N terminal of human LTC4S. Synthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY