Antibodies

Jump to Filters
View as table Download
MMP7 Rabbit Polyclonal Antibody
TA312003

USD 380.00

2 Weeks

Rabbit polyclonal anti-MMP-7 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP-7.
MMP7 Rabbit Polyclonal Antibody
TA339253

USD 485.00

5 Days

Rabbit Polyclonal Anti-MMP7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP7 antibody: synthetic peptide directed towards the C terminal of human MMP7. Synthetic peptide located within the following region: AATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGK
MMP7 Rabbit Polyclonal Antibody
TA347437

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-MMP7 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP7 Antibody: A synthesized peptide derived from human MMP7