Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 8 of 8 results

(reset)

BMP4 Mouse Monoclonal Antibody [Clone ID: UMAB42]

UM500038

USD 564.00

In Stock

BMP4 mouse monoclonal antibody,clone UMAB42

Applications	10k-ChIP, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

GLI1 Mouse Monoclonal Antibody [Clone ID: UMAB170]

UM800063

USD 564.00

In Stock

GLI1 mouse monoclonal antibody,clone UMAB170

Applications	10k-ChIP, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

BMP4 Mouse Monoclonal Antibody [Clone ID: OTI6B7]

TA500014

USD 447.00

In Stock

Anti-BMP4 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

GLI2 Mouse Monoclonal Antibody [Clone ID: OTI1G1]

TA804601

USD 447.00

In Stock

GLI2 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

WNT2 Rabbit Polyclonal Antibody

TA351948

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-WNT2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human WNT2

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

WNT5A Rabbit Polyclonal Antibody

TA329908

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-WNT5A Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

WNT3A Mouse Monoclonal Antibody [Clone ID: 3A6]

AM09053PU-N

USD 430.00

3 Weeks

WNT3A mouse monoclonal antibody, clone 3A6, Purified

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

WNT2 Rabbit Polyclonal Antibody

TA329906

USD 539.00

5 Days

Rabbit Polyclonal Anti-WNT2 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-WNT2 antibody: synthetic peptide directed towards the middle region of human WNT2. Synthetic peptide located within the following region: GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNR

1 - 8 of 8 results