USD 447.00
In Stock
GNA15 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
GNA15 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
GNA15 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
GNA15 mouse monoclonal antibody,clone OTI1D3
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GNA15 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNA15 antibody: synthetic peptide directed towards the N terminal of human GNA15. Synthetic peptide located within the following region: ARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPG |