Antibodies

Jump to Filters
View as table Download
Rab4 (RAB4A) Rabbit Polyclonal Antibody
TA342684

USD 539.00

In Stock

Rabbit Polyclonal Anti-RAB4A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB4A antibody is: synthetic peptide directed towards the C-terminal region of Human RAB4A. Synthetic peptide located within the following region: VQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECG
Rab4 (RAB4A) Goat Polyclonal Antibody
AB238239-200

USD 330.00

In Stock

Goat Polyclonal Anti-Rab4 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 105 aa to the C-terminus of Rab4a produced in E. coli.