Antibodies

Jump to Filters
View as table Download
NNMT Rabbit Monoclonal Antibody [Clone ID: OTIR1F6]
TA591036

USD 516.00

In Stock

Rabbit monoclonal anti-NNMT antibody for SISCAPA, clone OTIR1F6

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CD38 Rabbit Polyclonal Antibody
TA351051

USD 380.00

In Stock

Rabbit Polyclonal Anti-CD38 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CD38
ENPP3 Rabbit Polyclonal Antibody
TA322680

USD 380.00

In Stock

Anti-ENPP3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 850-864 amino acids of Human ectonucleotide pyrophosphatase/phosphodiesterase 3
NT5C1A Rabbit Polyclonal Antibody
TA350240

USD 380.00

In Stock

Rabbit Polyclonal Anti-NT5C1A Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NT5C1A
Aldehyde Oxidase (AOX1) Rabbit Polyclonal Antibody
TA313452

USD 380.00

In Stock

Rabbit polyclonal anti-AOX1 antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AOX1.
NT5C1A Rabbit Polyclonal Antibody
TA315925

USD 380.00

In Stock

Rabbit polyclonal anti-NT5C1A antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NT5C1A.
ENPP3 Rabbit Polyclonal Antibody
TA322679

USD 380.00

In Stock

Anti-ENPP3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 850-864 amino acids of Human ectonucleotide pyrophosphatase/phosphodiesterase 3
Aldehyde Oxidase (AOX1) Rabbit Polyclonal Antibody
TA890040

USD 407.00

In Stock

Rabbit polyclonal anti-AOX1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AOX1
Bone marrow stromal cell antigen 1 (BST1) Rabbit Polyclonal Antibody
TA313527

USD 380.00

In Stock

Rabbit polyclonal anti-BST1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BST1.
NAD Synthetase (NADSYN1) Rabbit Polyclonal Antibody
TA334335

USD 539.00

In Stock

Rabbit Polyclonal Anti-NADSYN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NADSYN1 antibody is: synthetic peptide directed towards the C-terminal region of Human NADSYN1. Synthetic peptide located within the following region: NQISYTPQDPRDLCGRILTTCYMASKNSSQETCTRARELAQQIGSHHISL