Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Acetyl-Histone H4 (Lys16) Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic Peptide of Histone H4 (Acetyl Lys16) (Acetylated) |
HIST4H4 (Citrulline R3) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from N-term region of Human Histone H4, containing Citrulline at position 3 |
HIST4H4 (acetyl K5) rabbit polyclonal antibody, Serum
| Applications | ChIP, ELISA, IF, IP, WB |
| Reactivities | Amphibian, Drosophila, Mammalian, Plant, Yeast |
| Conjugation | Unconjugated |
| Immunogen | Ovalbumin-conjugated peptide. |
Phospho-Histone H4 (Ser1) Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S1 of human Histone H4.Email for sequence (Phosphorylated) |
Rabbit monoclonal to Acetylated Histone H4 Lysine 8 (K8ac)
| Applications | ChIP, ELISA, ICC, LMNX, WB |
| Reactivities | Human, Vertebrates |
| Conjugation | Unconjugated |
Rabbit monoclonal to Acetylated Histone H4 Lysine 20 (K20ac)
| Applications | ChIP, ELISA, ICC, LMNX, WB |
| Reactivities | Human, Vertebrates |
| Conjugation | Unconjugated |
Rabbit monoclonal to Acetylated Histone H4 Lysine 12 (K12ac)
| Applications | ChIP, ELISA, ICC, LMNX, WB |
| Reactivities | Human, Vertebrates |
| Conjugation | Unconjugated |
HIST4H4 (acetylated) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IP, WB |
| Reactivities | Amphibian, Drosophila, Mammalian, Yeast |
| Conjugation | Unconjugated |
| Immunogen | KLH-conjugated peptide acetylated at lysines 5,8,12,16 |
Rabbit Polyclonal Anti-HIST1H4A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HIST1H4A antibody is: synthetic peptide directed towards the N-terminal region of Human HIST1H4A. Synthetic peptide located within the following region: LGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK |
Rabbit monoclonal to Phospho-Histone H4 (Ser1), H4S1p
| Applications | ELISA, ICC, LMNX, WB |
| Reactivities | Human, Vertebrates |
| Conjugation | Unconjugated |
Rabbit monoclonal to Monomethylated Histone H4 Arginine 3, H4R3me1
| Applications | ELISA, ICC, LMNX, WB |
| Reactivities | Human, Vertebrates |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- H4C1
Applications
- WB