Antibodies

Jump to Filters
View as table Download
GRSF1 Rabbit Polyclonal Antibody
TA345789

USD 539.00

5 Days

Rabbit Polyclonal Anti-GRSF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRSF1 antibody: synthetic peptide directed towards the middle region of human GRSF1. Synthetic peptide located within the following region: IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV
GRSF1 Rabbit Polyclonal Antibody
TA376808

USD 365.00

3 Weeks

GRSF1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRSF1.
GRSF1 Rabbit Polyclonal Antibody
TA345788

USD 485.00

5 Days

Rabbit Polyclonal Anti-GRSF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRSF1 antibody: synthetic peptide directed towards the N terminal of human GRSF1. Synthetic peptide located within the following region: SCRRTGAACLPFYSAASYPALRASLLPQSLAAAAAVPTRSYSQESKTTYL