GH2 mouse monoclonal antibody,clone OTI5B11
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GH2 mouse monoclonal antibody,clone OTI5B11
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GH2 mouse monoclonal antibody,clone OTI5B11
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GH2 mouse monoclonal antibody,clone OTI5B11, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
GH2 mouse monoclonal antibody,clone OTI5B11, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit Polyclonal Anti-GH2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GH2 |
GH2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GH2 |
GH2 mouse monoclonal antibody,clone OTI5B11
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GH2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 18-45 amino acids from the N-terminal region of human Growth hormone 2 |
Rabbit Polyclonal anti-GH2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GH2 antibody: synthetic peptide directed towards the middle region of human GH2. Synthetic peptide located within the following region: LEEGIQTLIGWKMAAPGLGRSSISPTASLTQNRTTMTHCSRTTGCSTASG |
Rabbit Polyclonal Anti-GH2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GH2 antibody: synthetic peptide directed towards the middle region of human GH2. Synthetic peptide located within the following region: NQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSC |