Anti-GABRR1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 57-70 amino acids of Human gamma-aminobutyric acid (GABA) A receptor, rho 1 |
Rabbit Polyclonal Anti-GABA(A) ?1 Receptor (extracellular)
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)ESTVHWPGREVHE, corresponding to amino acid residues 23-35 of rat GABA(A) ?1 receptor. Extracellular, N-terminus. |
Rabbit Polyclonal anti-GABRR1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRR1 antibody: synthetic peptide directed towards the N terminal of human GABRR1. Synthetic peptide located within the following region: MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVH |
Rabbit anti-GABRR1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GABRR1 |
Rabbit Polyclonal Anti-GABRR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRR1 antibody: synthetic peptide directed towards the N terminal of human GABRR1. Synthetic peptide located within the following region: EMSKKGRPQRQRREVHEDAHKQVSPILRRSPDITKSPLTKSEQLLRIDDH |
GABRR1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human GBRR1 |
GABRR1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human GABRR1 (NP_002033.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China