Rabbit Polyclonal Anti-WASF3 Antibody
| Applications | WB |
| Reactivities | Human, Chicken, Turkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WASF3 antibody: synthetic peptide directed towards the N terminal of human WASF3. Synthetic peptide located within the following region: NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK |
Rabbit Polyclonal Anti-WASF3 Antibody
| Applications | WB |
| Reactivities | Human, Chicken, Turkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WASF3 antibody: synthetic peptide directed towards the middle region of human WASF3. Synthetic peptide located within the following region: RIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGS |
Rabbit Polyclonal Anti-EIF4G2 Antibody
| Applications | WB |
| Reactivities | Human, Chicken, Turkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF4G2 antibody: synthetic peptide directed towards the C terminal of human EIF4G2. Synthetic peptide located within the following region: KGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPV |
Turkey IgG (H+L chain) goat polyclonal antibody, Biotin
| Applications | Immunofluorescence. ELISA. Western blotting. Dot- and Slot-Immunoblotting. Immunohistochemistry. |
| Reactivities | Turkey |
| Conjugation | Biotin |
Turkey IgG (H+L chain) goat polyclonal antibody, FITC
| Applications | Immunofluorescence: < / = 1 µg/10e6 cells. ELISA. Western blotting. Dot- and Slot-Immunoblotting. Immunohistochemistry. |
| Reactivities | Turkey |
| Conjugation | FITC |
Turkey IgG (H+L chain) goat polyclonal antibody, Purified
| Applications | Immunofluorescence. ELISA. Western blotting. Dot- and Slot-Immunoblotting. Immunohistochemistry. |
| Reactivities | Turkey |
| Conjugation | Unconjugated |
Turkey IgG (H+L chain) goat polyclonal antibody, PE
| Applications | Immunofluorescence. ELISA. Western blotting. Dot- and Slot-Immunoblotting. Immunohistochemistry. |
| Reactivities | Turkey |
| Conjugation | PE |
HSP27 (HSPB1) mouse monoclonal antibody, clone SJ-25, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Turkey |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
