Antibodies

Jump to Filters
View as table Download
C9orf40 Rabbit Polyclonal Antibody
TA344943

USD 539.00

5 Days

Rabbit Polyclonal Anti-C9orf40 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C9orf40 antibody: synthetic peptide directed towards the middle region of human C9orf40. Synthetic peptide located within the following region: HNEEFWQYNTFQYWRNPLPPIDLADIEDLSEDTLTEATLQGRNEGAEVDM
C9orf40 Rabbit Polyclonal Antibody
TA362451

USD 539.00

5 Days

C9ORF40 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of human C9ORF40