Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-FABP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the N terminal of human FABP3. Synthetic peptide located within the following region: NGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHL |
Rabbit Polyclonal Anti-FABP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV |
Rabbit Polyclonal Anti-FABP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: DETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHG |
FABP3 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-133 of human FABP3 (NP_004093.1). |
| Modifications | Unmodified |
FABP3 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human FABP3 |
FABP3 goat polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_004093.1. |
FABP3 mouse monoclonal antibody, clone 67D3, Biotin
| Applications | ELISA, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
FABP3 mouse monoclonal antibody, clone 67D3, Purified
| Applications | ELISA, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
FABP3 mouse monoclonal antibody, clone 66E2, Biotin
| Applications | ELISA, IP, WB |
| Reactivities | Human, Mouse, Porcine, Rat |
| Conjugation | Biotin |
FABP3 mouse monoclonal antibody, clone 66E2, Purified
| Applications | ELISA, IP, WB |
| Reactivities | Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
FABP3 mouse monoclonal antibody, clone 22
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FABP3 mouse monoclonal antibody, clone 30
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FABP3 mouse monoclonal antibody, clone 31
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- FABP3
Reactivities
- Human
Applications
- WB