Germany
Japan
United Kingdom
China
RBL1 mouse monoclonal antibody,clone OTI4A10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
USD 509.00
2 Weeks
USD 509.00
2 Weeks
Carrier-free (BSA/glycerol-free) RBL1 mouse monoclonal antibody,clone OTI4A10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
RBL1 mouse monoclonal antibody,clone OTI4A10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 509.00
2 Weeks
RBL1 mouse monoclonal antibody,clone OTI4A10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RBL1 mouse monoclonal antibody,clone OTI4E1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-RBL1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBL1 antibody: synthetic peptide directed towards the N terminal of human RBL1. Synthetic peptide located within the following region: FLDIFQNPYEEPPKLPRSRKQRRIPCSVKDLFNFCWTLFVYTKGNFRMIG |
Rabbit Polyclonal Anti-RBL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBL1 antibody: synthetic peptide directed towards the middle region of human RBL1. Synthetic peptide located within the following region: NTIYVGRVKSFALKYDLANQDHMMDAPPLSPFPHIKQQPGSPRRISQQHS |
RBL1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RBL1 |
RBL1 mouse monoclonal antibody,clone OTI4A10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- P107
Applications
- WB
Pathways
- TGF-beta signaling pathway