Antibodies

Jump to Filters
View as table Download
FLAD1 (C-term) Rabbit Polyclonal Antibody
AP51675PU-N

USD 580.00

2 Weeks

FLAD1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 558~587 amino acids from the C-terminal region of Human FAD synthetase.
FLAD1 Rabbit Polyclonal Antibody
TA331022

USD 539.00

5 Days

Rabbit polyclonal Anti-FLAD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FLAD1 antibody: synthetic peptide directed towards the N terminal of human FLAD1. Synthetic peptide located within the following region: PGRSVTAGIIIVGDEILKGHTQDTNTFFLCRTLRSLGVQVCRVSVVPDEV