Antibodies

Jump to Filters
View as table Download
CYP2A13 Rabbit Polyclonal Antibody
AP06775PU-N

USD 465.00

3 Weeks

CYP2A13 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 306-360 of Human CYP2A13.
CYP2A13 Rabbit Polyclonal Antibody
TA313721

USD 380.00

In Stock

Rabbit polyclonal Cytochrome P450 2A13 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2A13.
CYP2A13 (C-term) Rabbit Polyclonal Antibody
AP17964PU-N

USD 580.00

2 Weeks

CYP2A13 (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human CYP2A13
CYP2A13 Rabbit Polyclonal Antibody
TA346221

USD 485.00

5 Days

Rabbit Polyclonal Anti-CYP2A13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2A13 antibody: synthetic peptide directed towards the C terminal of human CYP2A13. Synthetic peptide located within the following region: DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF
CYP2A7 Rabbit Polyclonal Antibody
TA360055

USD 539.00

5 Days

CYP2A7 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse CP2AD