Rabbit Polyclonal GRF-1 (Tyr1105) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GRF-1 around the phosphorylation site of Tyrosine 1105 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-GRLF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRLF1 antibody: synthetic peptide directed towards the N terminal of human GRLF1. Synthetic peptide located within the following region: RPSADEFHLDHTSVLSTSDFGGRVVNNDHFLYWGEVSRSLEDCVECKMHI |
Germany
Japan
United Kingdom
China