GATM mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GATM mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GATM mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GATM mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GATM mouse monoclonal antibody, clone OTI1E3 (formerly 1E3), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GATM mouse monoclonal antibody, clone OTI1E3 (formerly 1E3), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) GATM mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GATM mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GATM mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GATM mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GATM mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-GATM Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GATM antibody: synthetic peptide directed towards the middle region of human GATM. Synthetic peptide located within the following region: PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPN |
GATM (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected between amino acids 70 and 100 of Human Glycine amidinotransferase |