Antibodies

Jump to Filters
View as table Download
EAAT2 (SLC1A2) Rabbit Polyclonal Antibody
TA334294

USD 539.00

5 Days

Rabbit Polyclonal Anti-SLC1A2 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC1A2 antibody: synthetic peptide directed towards the N terminal of human SLC1A2. Synthetic peptide located within the following region: PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTK
EAAT2 (SLC1A2) Rabbit Polyclonal Antibody
TA334295

USD 539.00

5 Days

Rabbit Polyclonal Anti-SLC1A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC1A2 antibody: synthetic peptide directed towards the middle region of human SLC1A2. Synthetic peptide located within the following region: LVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEM