USD 447.00
In Stock
ASNS (Asparagine synthetase) mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
ASNS (Asparagine synthetase) mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
ASNS (Asparagine synthetase) mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 600.00
4 Weeks
Carrier-free (BSA/glycerol-free) ASNS mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ASNS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ASNS |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) ASNS mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
ASNS (Asparagine synthetase) mouse monoclonal antibody, clone OTI1A10 (formerly 1A10), Biotinylated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
ASNS (Asparagine synthetase) mouse monoclonal antibody, clone OTI1A10 (formerly 1A10), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
ASNS (Asparagine synthetase) mouse monoclonal antibody, clone OTI1B2 (formerly 1B2), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
ASNS (Asparagine synthetase) mouse monoclonal antibody, clone OTI1B2 (formerly 1B2), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit anti-ASNS Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 212-561 of human ASNS (NP_001664.3). |
Rabbit Polyclonal Anti-ASNS Antibody
Applications | WB |
Reactivities | Rat, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ASNS antibody: synthetic peptide directed towards the C terminal of human ASNS. Synthetic peptide located within the following region: SVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADR |
USD 200.00
2 Days
ASNS (Asparagine synthetase) mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 200.00
In Stock
ASNS (Asparagine synthetase) mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".