Anti-ACAT2 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-ACAT2 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-ACAT2 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-ACAT2 mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 509.00
2 Weeks
Anti-ACAT2 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Biotin |
Anti-ACAT2 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | HRP |
Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ACAT2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | FC, IF, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-ACAT2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACAT2 antibody: synthetic peptide directed towards the middle region of human ACAT2. Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR |
Anti-ACAT2 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit anti-ACAT2 polyclonal antibody
Applications | WB |
Reactivities | Human, Rat, Sheep, Pig, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ACAT 2 |