Germany
Japan
United Kingdom
China
USD 509.00
2 Weeks
N4BP2L2 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Antibodies
View as table Download
N4BP2L2 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 509.00
2 Weeks
N4BP2L2 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
N4BP2L2 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 509.00
2 Weeks
N4BP2L2 mouse monoclonal antibody, clone OTI5A3 (formerly 5A3), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
N4BP2L2 mouse monoclonal antibody, clone OTI5A3 (formerly 5A3), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 509.00
2 Weeks
N4BP2L2 mouse monoclonal antibody, clone OTI7F5 (formerly 7F5), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
N4BP2L2 mouse monoclonal antibody, clone OTI7F5 (formerly 7F5), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 509.00
2 Weeks
N4BP2L2 mouse monoclonal antibody, clone OTI3F12 (formerly 3F12), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 509.00
2 Weeks
N4BP2L2 mouse monoclonal antibody, clone OTI3F12 (formerly 3F12), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit polyclonal anti-N4BP2L2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human N4BP2L2. |
Rabbit Polyclonal Anti-N4BP2L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-N4BP2L2 Antibody: synthetic peptide directed towards the N terminal of human N4BP2L2. Synthetic peptide located within the following region: EYQMSISIVMNSVEPSHKSTQRPPPPQGRQRERVLKKTGHRLSKTKQKRN |
Rabbit Polyclonal Anti-N4BP2L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-N4BP2L2 Antibody: synthetic peptide directed towards the middle region of human N4BP2L2. Synthetic peptide located within the following region: TSCSLGVTSDFHFLNERFDRKLKRWEEPKELPAEDSQDLTSTDYRSLELP |
N4BP2L2 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
N4BP2L2 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- N4BP2L2
Applications
- WB