Rabbit Polyclonal Anti-YARS2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human YARS2 |
Rabbit Polyclonal Anti-YARS2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human YARS2 |
Rabbit Polyclonal Anti-YARS2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-YARS2 Antibody is: synthetic peptide directed towards the C-terminal region of Human YARS2. Synthetic peptide located within the following region: QPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVH |
Rabbit Polyclonal Anti-Yars2 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Yars2 Antibody is: synthetic peptide directed towards the middle region of Rat Yars2. Synthetic peptide located within the following region: NVIALVGGSTALLGDPSGRTKEREALSAECVRANARALQRGLETLAANHA |