Antibodies

View as table Download

Rabbit polyclonal anti-N4BP2L2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human N4BP2L2.

Rabbit Polyclonal Anti-N4BP2L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-N4BP2L2 Antibody: synthetic peptide directed towards the N terminal of human N4BP2L2. Synthetic peptide located within the following region: EYQMSISIVMNSVEPSHKSTQRPPPPQGRQRERVLKKTGHRLSKTKQKRN

Rabbit Polyclonal Anti-N4BP2L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-N4BP2L2 Antibody: synthetic peptide directed towards the middle region of human N4BP2L2. Synthetic peptide located within the following region: TSCSLGVTSDFHFLNERFDRKLKRWEEPKELPAEDSQDLTSTDYRSLELP