Antibodies

Jump to Filters
View as table Download
GATA6 Rabbit Monoclonal Antibody [Clone ID: OTIR5F2]
TA592953

USD 428.00

In Stock

GATA6 Rabbit monoclonal antibody,clone OTIR5F2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GATA6 Rabbit Monoclonal Antibody [Clone ID: OTIR5B8]
TA592954

USD 428.00

In Stock

GATA6 Rabbit monoclonal antibody,clone OTIR5B8

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
GATA6 Rabbit Monoclonal Antibody [Clone ID: OTIR3H6]
TA592957

USD 428.00

In Stock

GATA6 Rabbit monoclonal antibody,clone OTIR3H6

Applications WB
Reactivities Human
Conjugation Unconjugated
GATA6 Rabbit Polyclonal Antibody
TA330599

USD 539.00

5 Days

Rabbit Polyclonal Anti-GATA6 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA6 antibody: synthetic peptide directed towards the N terminal of human GATA6. Synthetic peptide located within the following region: PEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAAAAASSPVYVPTTR
GATA6 Rabbit Polyclonal Antibody
TA329425

USD 539.00

5 Days

Rabbit Polyclonal anti-GATA6 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA6 antibody: synthetic peptide directed towards the middle region of human GATA6. Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS
GATA6 Rabbit Polyclonal Antibody
TA312214

USD 380.00

4 Weeks

Rabbit polyclonal anti-GATA6 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human GATA6.
GATA6 Rabbit Polyclonal Antibody
TA376493

USD 365.00

3 Weeks

GATA6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human GATA6 (NP_005248.2).
Modifications Unmodified