Rabbit anti-SIRT7 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SIRT7 |
Rabbit anti-SIRT7 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SIRT7 |
SIRT7 (35-51, 361-377) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A mixture of synthetic peptides corresponding to amino acids 35-51 and 361-377 of human SIRT7. |
Rabbit Polyclonal Anti-SIRT7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SIRT7 antibody: synthetic peptide directed towards the middle region of human SIRT7. Synthetic peptide located within the following region: GEEGSHSRKSLCRSREEAPPGDRGAPLSSAPILGGWFGRGCTKRTKRKKV |
Rabbit Polyclonal Anti-SIRT7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SIRT7 antibody: synthetic peptide directed towards the C terminal of human SIRT7. Synthetic peptide located within the following region: DVMRLLMAELGLEIPAYSRWQDPIFSLATPLRAGEEGSHSRKSLCRSREE |