H4C1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human H4C1 |
H4C1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human H4C1 |
H4C1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human H4C1 |
H4C1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human H4C1 |
Histone H4 Rabbit polyclonal Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Histone H4. AA range:6-55 |
Acetyl-Histone H4 (Lys16) Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic Peptide of Histone H4 (Acetyl Lys16) (Acetylated) |
HIST4H4 (acetyl K5) rabbit polyclonal antibody, Serum
Applications | ChIP, ELISA, IF, IP, WB |
Reactivities | Amphibian, Drosophila, Mammalian, Plant, Yeast |
Conjugation | Unconjugated |
Immunogen | Ovalbumin-conjugated peptide. |
Phospho-Histone H4 (Ser1) Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S1 of human Histone H4.Email for sequence (Phosphorylated) |
Rabbit monoclonal to Acetylated Histone H4 Lysine 8 (K8ac)
Applications | ChIP, ELISA, ICC, LMNX, WB |
Reactivities | Human, Vertebrates |
Conjugation | Unconjugated |
Rabbit monoclonal to Acetylated Histone H4 Lysine 20 (K20ac)
Applications | ChIP, ELISA, ICC, LMNX, WB |
Reactivities | Human, Vertebrates |
Conjugation | Unconjugated |
Rabbit monoclonal to Acetylated Histone H4 Lysine 12 (K12ac)
Applications | ChIP, ELISA, ICC, LMNX, WB |
Reactivities | Human, Vertebrates |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HIST1H4A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HIST1H4A antibody is: synthetic peptide directed towards the N-terminal region of Human HIST1H4A. Synthetic peptide located within the following region: LGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK |
Rabbit monoclonal to Phospho-Histone H4 (Ser1), H4S1p
Applications | ELISA, ICC, LMNX, WB |
Reactivities | Human, Vertebrates |
Conjugation | Unconjugated |
Rabbit monoclonal to Monomethylated Histone H4 Arginine 3, H4R3me1
Applications | ELISA, ICC, LMNX, WB |
Reactivities | Human, Vertebrates |
Conjugation | Unconjugated |
Rabbit monoclonal to Acetylated Histone H4 Lysine 5 (K5ac)
Applications | ELISA, ICC, LMNX, WB |
Reactivities | Human, Vertebrates |
Conjugation | Unconjugated |
Rabbit monoclonal to Acetylated Histone H4 Lysine 16 (K16ac)
Applications | ELISA, LMNX, WB |
Reactivities | Human, Vertebrates |
Conjugation | Unconjugated |