Collagen V (COL5A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Collagen type V purified from Human and Bovine placenta |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Collagen type V purified from Human and Bovine placenta |
Rabbit polyclonal Collagen V a1 antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Collagen V a1. |
Rabbit polyclonal anti-OR10J6 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human OR10J6. |
Collagen V (COL5A1) rabbit polyclonal antibody, Biotin
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian |
Conjugation | Biotin |
Immunogen | Collagen Type V from Human and Bovine placenta. |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Collagen type V purified from Human and Bovine placenta |
Rabbit Polyclonal Anti-COL5A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COL5A1 antibody: synthetic peptide directed towards the N terminal of human COL5A1. Synthetic peptide located within the following region: PGMPANQDTIYEGIGGPRGEKGQKGEPAIIEPGMLIEGPPGPEGPAGLPG |
Rabbit Polyclonal Anti-Collagen Valpha 1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Collagen Valpha 1 Antibody: A synthesized peptide derived from human Collagen Valpha 1 |