BMAL1 Rabbit polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human BMAL1 around the non-acetylation site of Lys538. AA range:501-550 |
Rabbit Polyclonal Anti-ARNTL Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of mouse ARNTL. Synthetic peptide located within the following region: SGVDCNRKRKGSATDYQLDDFAFEESMDTDKDDPHGRLEYAEHQGRIKNA |
Rabbit Polyclonal Anti-Arntl Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Arntl antibody is: synthetic peptide directed towards the C-terminal region of Mouse Arntl. Synthetic peptide located within the following region: GQAQETPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMS |
ARNTL rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARNTL |
BMAL1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BMAL1. |
Germany
Japan
United Kingdom
China
