Phospho-PAK4/5/6 (Ser474/Ser560/Ser602) Rabbit polyclonal Antibody
| Applications | FC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Phospho-PAK4 + PAK5 + PAK6 (S474 + S560 + S602) (Phosphorylated) |
Rabbit Polyclonal Anti-Pak4 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pak4 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACITSIQPGAPKTIVR |
Rabbit anti PAK4(pS474) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding the epitope RKSLV-with a phosphorylation at Serine 474 of human PAK4. This sequence is also identical within human, rat, mouse, chicken, bovine and dog species. |
Rabbit anti PAK4 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from internal sequence of human PAK4. This sequence is also identical within human, rat, mouse, chicken, bovine and dog species. |
Germany
Japan
United Kingdom
China