Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-HSF2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HSF2. |
Antibodies
View as table Download
Anti-HSF2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-HSF2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-HSF2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSF2 antibody: synthetic peptide directed towards the middle region of human HSF2. Synthetic peptide located within the following region: SSVQMNPTDYINNTKSENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQY |
Rabbit Polyclonal Anti-Hsf2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Hsf2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SAIEQGSTTASSEVVPSVDKPIEVDELLDSSLDPEPTQSKLVRLEPLTEA |
Active filters
Target Symbol
- HSF2
Reactivities
- Mouse
Applications
- WB
Isotypes
- IgG