Germany
Japan
United Kingdom
China
BDNF rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Highly purified (>98%) E.coli derived, 27.0 kDa recombinant Human/Mouse/Rat BDNF (Cat.-No PA047) |
Antibodies
View as table Download
BDNF rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Highly purified (>98%) E.coli derived, 27.0 kDa recombinant Human/Mouse/Rat BDNF (Cat.-No PA047) |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Human, Macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
BDNF rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | E.coli-derived, 27.0 kDa Recombinant Human/Mouse/Rat BDNF (Cat.-No PA047). |
BDNF rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | E.coli-derived, 27.0 kDa Recombinant Human/Mouse/Rat BDNF (Cat.-No PA047). |
BDNF rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide mapping at the middle region of human BDNF |
BDNF Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BDNF |
| Modifications | Unmodified |
Active filters
Target Symbol
- BDNF
Reactivities
- Mouse
Applications
- WB
Isotypes
- IgG